Showing results for Protein Name = CF1 beta subunit of ATP synthase
| PiperID | SEQUENCE | Ion | Score | Hits | Mass | Modification | Protein Name | Origin | Accession |
|---|---|---|---|---|---|---|---|---|---|
| Piper635 | NGITMIRNHIVSAAAAVTTQEGTIAQIIGPVCDVTFKAGNMPNIYDAVLVETK | 567 | 22.57 | 2 | 5670.9176 | [N-term] Acetyl (N-term)|[32] Carbamidomethyl (C)|[41] Oxidation (M)|[43] Deamidated (NQ) | CF1 beta subunit of ATP synthase | chloroplast | gi|699008381 |
| Piper723 | RNGITMIRNHIVSAAAAVTTQEGTIAQIIGPVCDVTFKAGNMPNIYDAVLVETK | 228 | 18.1 | 2 | 5728.9317 | [2] Deamidated (NQ)|[6] Oxidation (M)|[44] Deamidated (NQ) | CF1 beta subunit of ATP synthase | chloroplast | gi|699008381 |